| RGAP LOCUS ID | LOC_Os12g42550 | ||||
| RAP-DB ID | Os12g0620400 | ||||
| Function | methyl-CpG binding domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 11 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.5 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.57 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.36 | ||||
| confidence value | 0.99 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsMeCP | ||||
| Function assigned as per literature | acts as a negative regulator of silicon, and can mediate the repression of the transcription from Os10g0167600, which inhibits the photoreactivation of the photolyase involved in the repair of CPDs | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | rice protoplast | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 27694845 | ||||
| Reference of localization | https://www.nature.com/articles/srep34569#f5 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.132 | ||||
| NLS score | -0.04 | ||||
| Protein Sequence | >LOC_Os12g42550.1 protein MATAGDEQQQQAAAAQTAEVTEAAAKEVVSVEMPAPEGWTKKFTPQRGGRFEIVFVSPTGEEIKNKRQLSQYLKAHPGGPASSEFDWGTGDTPRRSARIS EKVKAFDSPEGEKIPKRSRNSSGRKGKQEKKEATENEEAKDAEADKEAPSEDAPKETDVETKPAEEAKEAPSEDAPKDTDVEMKTAEDASKTADADTPAP APAGTEKEDAKPAESEAAPPAPSEGGEKKEDAKPAEPEAAAAPPSNPTEPSAPKAAAAAPVENSADKGPHQDSQPPSAAAPAKESSPVNNGQLPAGASAV KCT |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | YES | ||||