| RGAP LOCUS ID | LOC_Os12g38051 | ||||
| RAP-DB ID | Os12g0568200 | ||||
| Function | metallothionein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 9 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.09 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.01 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.87 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsMT-I-4b|OsMT1c | ||||
| Function assigned as per literature | OsMT-I-4b are involved in tapetum degeneration | ||||
| Subcellular localization as per literature | OsMT-I-4b colocalizes with DTC1 in cytoplasm | ||||
| Cells used for localization experiment | protoplasts prepared from rice Oc cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26697896 | ||||
| Reference of localization | http://www.plantphysiol.org/content/170/3/1611 | ||||
| Is Subcellular localization evidence by author available ? | Yes | ||||
| Image | |||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.063 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os12g38051.1 protein MSCGGSCNCGSCGCGGGCGKMYPDLAEKITTTTTTATTVLGVAPEKGHFEVMVGKAAESGEAAHGCSCGSSCKCNPCNC |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | No | ||||