| RGAP LOCUS ID | LOC_Os12g35320 | ||||
| RAP-DB ID | Os12g0538500 | ||||
| Function | RING finger and CHY zinc finger domain-containing protein 1, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | cyto | ||||
| score | 12 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 3.265 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.09 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 60.38 | ||||
| confidence value | 0.29 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | SDEL1 | ||||
| Function assigned as per literature | SDEL1 facilitates the degradation of SPX4 to modulate PHR2 activity and regulate Pi homeostasis and Pi signaling in response to external Pi availability in rice | ||||
| Subcellular localization as per literature | cytoplasm and nucleus | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 31002982 | ||||
| Reference of localization | https://www.cell.com/molecular-plant/pdf/S1674-2052(19)30132-7.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.092 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os12g35320.1 protein MGGAHFPGEGEVVAGEGDAVVPLRDVGKMEHGCEHYRRRCKIVAPCCGEVFACRHCHNDATASGDRHTICRQDVEKVVCLLCDTEQPVSQVCINCGVNMG EYFCDVCKFYDDDTEKGQFHCYDCGICRVGGKENYFHCAKCGSCYAVALRDNHQCVENSMRQNCPICYEYLFDSLKGTRVLDCGHTMHMECFSEMVEHNK YTCPICSKTALDMTHHWALLDQEIEATIMPPVYRYKVWVLCNDCNKVSEVDFHVIGHKCSHCNSYNTRSTSRPADLSGSSSPSTSDSSENNP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||