LOC_Os12g32284
| RGAP LOCUS ID | LOC_Os12g32284 |
| RAP-DB ID | Os12g0507600 |
| Function | glycine-rich protein, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 12 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 1.487 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.01 |
4) Y-Loc Prediction |
|
| localization | Secreted pathw |
| score | |
| confidence value | 1 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | RIF4 |
| Function assigned as per literature | |
| Subcellular localization as per literature | Cytoplasm |
| Cells used for localization experiment | Rice protoplasts |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 26224552 |
| Reference of localization | https://thericejournal.springeropen.com/articles/10.1186/s12284-014-0021-6 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.082 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os12g32284.1 protein MVVNNFTGPGIGLGFGIGCGFGVGWGFGGMPLNMFGLGIGGGCGVGLGLGWGFGKAYGCQYRSSRVQFQGIEFQKKTEGDEASSLVSPERVEKSRPYG |
GO Analysis |
|
| Presence of Splice variants | No |