 
    | RGAP LOCUS ID | LOC_Os12g03816 | ||||
| RAP-DB ID | Os12g0132300 | ||||
| Function | OsCML3 - Calmodulin-related calcium sensor protein, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | Nuclear | ||||
| score | 6 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 3.279 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.4 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Nuclear | ||||
| score | 66.09 | ||||
| confidence value | 0.83 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OsCML3 | ||||
| Function assigned as per literature | OsCML3 may provide a mechanism for manipulating the DNA-binding ability of OsHMGB1 in the nucleus with the CTE providing an intracellular Ca2+ regulatory switch | ||||
| Subcellular localization as per literature | Plasma membrane but in nucleus when interacted with OsHMGB1 | ||||
| Cells used for localization experiment | Tobacco leaf cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 26423116 | ||||
| Reference of localization | https://academic.oup.com/abbs/article/47/11/880/1446 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.109 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os12g03816.1 protein MDHLTKEQIAEFREAFNLFDKDGDGTITSKELGTVMGSLGQSPTEAELKKMVEEVDADGSGSIEFEEFLGLLARKLRDTGAEDDIRDAFRVFDKDQNGFI TPDELRHVMANLSDPLSDDELADMLHEADSDGDGQINYNEFLKVMMAKRRQNMMEGHGSGGHRSSNSHKKSGCCGPNSSCTIL | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| 5 | 
 | ||||
| Presence of Splice variants | No | ||||