RGAP LOCUS ID | LOC_Os12g01550 | ||||
RAP-DB ID | Os12g0106200 | ||||
Function | DUF260 domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | mito | ||||
score | 7 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.462 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.34 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 9 | ||||
confidence value | 0.1 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | LOB/LBD | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | LBD12-1 | ||||
Function assigned as per literature | LBD12-1 plays an important role in shoot apical meristem (SAM) size determination by regulating the expression of AGO10 under stress conditions | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Root cells of transgenic rice plant | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 27895202 | ||||
Reference of localization | http://www.plantphysiol.org/content/173/1/801.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.077 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os12g01550.1 protein MAGSGSGTPCASCKLLRRRCTSECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLLDVPPPQRPDAVSSLVYEANARMRDPVYGCVAAISFLQNQVSQLQM QLALAHAETAALQLQLQQQHQDQDDHHHQQCILENAAAHHQLMLQEAFLKKESMWT |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |