RGAP LOCUS ID | LOC_Os11g34300 | ||||
RAP-DB ID | Os11g0545600 | ||||
Function | chromatin modification-related protein EAF3, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.833 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.75 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.93 | ||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | MRG702 | ||||
Function assigned as per literature | MRG702 is a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36 and Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Root cells of the transgenic plants | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 25855537 | ||||
Reference of localization | http://www.plantphysiol.org/content/168/4/1275.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 1 | ||||
Basic residues % | 0.18 | ||||
NLS score | 0.33 | ||||
Protein Sequence | >LOC_Os11g34300.2 protein MSQAGSESAAAKEPSFKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLIFNEYSWDEWVTNDRLLKLTDENIRKQQELEKSQVVDKSVKSGRSAQH KPKGSNDAKTDKEDTKIIIKGKKRKSQPGGTEEKERKSSESLFMSHFPSTLKKQLVDDWEFVTQLGKLVKLPRSPTVDDILKKYLEHRTKKDNKINDSYA EILKGLRCYFDKALPAMLLYKKERQQYSEEVKGDVSPSTIYGAEHLLRLFVKLPELLASVNMEEDALNKLQQKLLDILKFLQKNQSSFFLSAYDGGSKGT DGIKTK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |