RGAP LOCUS ID | LOC_Os11g14430 | ||||
RAP-DB ID | Os11g0250000 | ||||
Function | APOBEC1 complementation factor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 12 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.453 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.33 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 1 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | RBS1 | ||||
Function assigned as per literature | RBS1 is a negative regulator of flowering time that itself is positively regulated by SPIN1 but negatively regulated by SPL11 in rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | N. benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 24498057 | ||||
Reference of localization | http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0087258 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 3 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.123 | ||||
NLS score | 0.47 | ||||
Protein Sequence | >LOC_Os11g14430.2 protein MSDRQQSEEPEEQVDLEGDDDNDVMDDDEDGYRRRRRREDSDEPDDDEEDPEVEGDGHGDAGTAAGEGGAHEMDKAAGGGGDGPEDDDEKRKWDELLALP PQGSEVFIGGLPRDTTEEDLRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKEAAQRAIEELHDKEHKGRTLRCSLSQAKHRLFVGNVPKGLGEEEL RKIIQGKGPGVVNIEMFKDLHDPSRNRGFLFVEYYNHACADYARQKLSAPNFKVDGSQLTVSWAEPKGSSDSSSAAAQVKTIYVKNLPENASKEKIKEIF EKHGEVTKVVLPPAKDGHKRDFGFVHFAERSSALKAVKGSEKYEFNGQVLEVSMAKPLGDKKPDHSFKPAGAPNFPLPPYGGYMGDPYGAYGGGGPGFNQ PMIYGRGPAPAGMRMVPMVLPDGRLGYVLLVEFPLHHQCDAVTGGMVAAEVVKGVMAGDIALTSFSFFFPFPCAASHHAV |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |