LOC_Os11g10590
| RGAP LOCUS ID | LOC_Os11g10590 |
| RAP-DB ID | Os11g0211800 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | extr |
| score | 8 |
2) CELLO Prediction |
|
| localization | Extracellular |
| score | 2.657 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.06 |
4) Y-Loc Prediction |
|
| localization | Secreted pathw |
| score | |
| confidence value | 1 |
| Number Of Software Predicting Nucleus | 0 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsDT11 |
| Function assigned as per literature | OsDT11 is involved in ABA-dependent drought tolerance in rice |
| Subcellular localization as per literature | Cell wall |
| Cells used for localization experiment | Tobacco epidermal cells |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 27718117 |
| Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-016-0544-x |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.08 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os11g10590.1 protein MASTKMAVVAILAALLLMAAVEPALATPPSLLPARKLQMPRLMDVVSAESKLACLPAGGFCMFRPMDCCGNCGCLYPVGVCYGSRCEE |
GO Analysis |
|
| Presence of Splice variants | No |