RGAP LOCUS ID | LOC_Os11g03300 | ||||
RAP-DB ID | Os11g0126900 | ||||
Function | NAC domain transcription factor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.453 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.77 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 85 | ||||
confidence value | 0.3 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | NAC | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | ONAC122|OsNAC10 | ||||
Function assigned as per literature | ONAC122 and ONAC131 have important roles in rice disease resistance responses through the regulated expression of other defense- and signaling-related genes | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Nicotiana benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 23103994 | ||||
Reference of localization | https://link.springer.com/journal/11103 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.087 | ||||
NLS score | 0.27 | ||||
Protein Sequence | >LOC_Os11g03300.1 protein MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKS ILSTPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMRLDDWVLCRIHKKSNDFNSSDQHDQEPEESTVEQLEDIHDN NSSEQPPAPADMNNQQSDFQPMTAMSMSKSCSLTDLLNTIDCAALSQFLLDGSSDAIAEPPAPPSPLIYTTPHPNYQTLNYNINSNSSMPHAFESRLDHH DGYVNNYNVNGLRRKRMMACSATSFDDGSSSNDFVHAVVKKPQLLPSDSRGSGFGGGYCNQQLSETATGFQFQNGNLLSHPFPLNNHLQMQ |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |