RGAP LOCUS ID | LOC_Os10g37640 | ||||
RAP-DB ID | Os10g0520700 | ||||
Function | HIT zinc finger domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 3 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.33 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.6 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.86 | ||||
confidence value | 0.94 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | LIP1 | ||||
Function assigned as per literature | LIP1 is involved in regulatation of rice leaf inclination through auxin signaling | ||||
Subcellular localization as per literature | Nucleus and cytoplasm | ||||
Cells used for localization experiment | Rice protoplasts and Nicotiana benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30496185 | ||||
Reference of localization | https://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1007829 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.117 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os10g37640.1 protein MEREVVVSEDAAASSSSSSSSAAAASFSLAETRVICRVCQKQFAQYTCPRCNARYCSLPCYKGHSVQCTESFMRENVMDELKQMQPEDESKKKMLDILKR FHLEEEDMDSEGEDESILSEELIQKVMSGDEIKLEDLSDDEIKRFRQALASGELSKMIEPWTPWWKKPSARSISLSPDGSQLIRQVSVEDTDTSDPMADP ESSISEIPEGPESALPSLEQLTRAEPSPLLAVHLVDILYSYCFTLRLHNGDWRSDPFGASTVALSVSKVMGEDAKPETVSEALTACIEETCSPAYRHTGG FRFAIALVDDIISLLTLGGNALVCALCDFRRLIHIGERMLKAEKLGKAERSRSTQKLRAADRKLYFMTCWVHEQPNEAWSSLARLVEVQKASLEELDCGS QFQRAGRKNDAQSKVLIEEI |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |