| RGAP LOCUS ID | LOC_Os10g32680 | ||||
| RAP-DB ID | Os10g0463800 | ||||
| Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Mitochondrial | ||||
| score | 1.13 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.32 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 8 | ||||
| confidence value | 0.44 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | FLO7 | ||||
| Function assigned as per literature | FLO7 is an unique plant regulator required for starch synthesis and amyloplast development within the peripheral endosperm | ||||
| Subcellular localization as per literature | Chloroplasts | ||||
| Cells used for localization experiment | rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26608643 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/67/3/633/2893332 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 2 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.115 | ||||
| NLS score | 0.62 | ||||
| Protein Sequence | >LOC_Os10g32680.1 protein MAVALAGARSPGAGAILSLRRLAPAAAAPVRLGGSGTPGTRRRRGIAMAAAASAPPAPADALPKGADSFFRTVISNMEKVYLSRNPTAKTILELVRSYDG DHICYDHFAFRTFGVDGYGIKSLAEFFTDFGYVPREELRFPAKKLRALWFSPPTNDGYTGTGVYGPLPRIFISELLVDELSPQSQDIIQKYIRTSGKGNK HATLASTSGELTWEKPIYSDFQVLSRESEYAAWTLVNGYALNHTTISTHRLISDIRSINKFNKFVEDNGFKLNSEGGILKVSPDGLLQQSSTVADSALFT FADGITESIPRSYIEFAERLVLPQFKDLPNDEVNEHHRRDGFEVGNADKIFESTSNDQLTRRSA |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | YES | ||||