| RGAP LOCUS ID | LOC_Os10g31850 | ||||
| RAP-DB ID | Os10g0456800 | ||||
| Function | RING finger and CHY zinc finger domain-containing protein 1, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 4 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 3.11 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.08 | ||||
4) Y-Loc Prediction |
|||||
| localization | Cytoplasm | ||||
| score | 62 | ||||
| confidence value | 0.63 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | DCA1 | ||||
| Function assigned as per literature | DCA1 acts as a transcriptional co-activator of DST and improve tolerance to abiotic stress in other important crop species | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Arabidopsis protoplasts. | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 26496194 | ||||
| Reference of localization | https://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1005617 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.109 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os10g31850.1 protein MELESEQHGCEHYTRGCRIRAPCCGEVFGCRHCHNEAKNSLEIHLNDRHEIPRHEIKKVICSLCDKEQDVQQYCSGCGACMGKYFCEKCNFFDDDVSKNQ YHCDGCGICRTGGVDKFFHCDKCGCCYSNVLRDSHHCVEGAMHHNCPVCFEYLFDSTKDISVLHCGHTIHLECLNVMRAHHHFACPVCSRSACDMSDAWK KLDEEVAATPMPEFYQKKMIWILCNDCGATSNVNFHVLAQKCPGCSSYNTRETRGCGRPAAARSTV |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | YES | ||||