| RGAP LOCUS ID | LOC_Os10g30850 | ||||
| RAP-DB ID | Os10g0445400 | ||||
| Function | zinc finger, RING-type, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 5.5 | ||||
2) CELLO Prediction |
|||||
| localization | PlasmaMembrane | ||||
| score | 2.507 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.11 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 5 | ||||
| confidence value | 0.15 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsHCI1 | ||||
| Function assigned as per literature | OsHCI1 plays an important role in regulation of heat-generated signals in plants | ||||
| Subcellular localization as per literature | Golgi apparatus and punctuate spots which rapidly moved to the nucleus under heat shock | ||||
| Cells used for localization experiment | Tobacco leaves and rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 23698632 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/64/10/2899/542627 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.134 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os10g30850.1 protein MSCEFFLPSPVAARGRWWWWGVCVWFISLFCRASEFLRDYDGAVIQMRMAYSAVAHFLVQWIDCKLAGALGLLKIMIYKVYADGTTALPEWEREASIRQF YGVIFPSLLQLPSGITELDDRKQRRLCLQKFRKVEERVSEVDLERELECGICLEVNAKIVLPDCAHSLCMRCFEDWNTKSKSCPFCRACLKKVNPSSLWL YTDDRDVVDMDTLTRENIRRLFMFISKLPLVVLHVVDLDIYEYRIK |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||