RGAP LOCUS ID | LOC_Os10g25850 | ||||
RAP-DB ID | Os10g0397900 | ||||
Function | nuclear transcription factor Y subunit, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 11 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.355 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.74 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.93 | ||||
confidence value | 0.98 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | Yes | ||||
Transcription factor category | CCAAT/NF_YA | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsNF-YA8 | ||||
Function assigned as per literature | Preferentially expressed in the rice endosperm | ||||
Subcellular localization as per literature | Nuclear | ||||
Cells used for localization experiment | Tobacco Leaf epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 29514259 | ||||
Reference of localization | https://academic.oup.com/jxb/article/69/10/2495/4920837 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 3 | ||||
Basic residues % | 0.157 | ||||
NLS score | 1.01 | ||||
Protein Sequence | >LOC_Os10g25850.1 protein MGFGESTQGNQRKLDGPGKVSTELSLVNLEAKNLHPKPECNQPIEHIPTKGMKCTPLLPLPTEHADDEPIYVNAKQYHAIIRRRQRRKIVGSEDKVAAIR KRILVEARQKQAKLRHRGKGGRFISIEHPLELSMDDQISKNGGSASPSSSTVSENSSNVNGFTGDL |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |