RGAP LOCUS ID | LOC_Os10g11580 | ||||
RAP-DB ID | Os10g0191900 | ||||
Function | histone-like transcription factor and archaeal histone, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.274 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.18 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.92 | ||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | Yes | ||||
Transcription factor category | CCAAT/NF_YC | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | NF-YC12|OsNF-YC12 | ||||
Function assigned as per literature | NF-YC12 coordinates multiple pathways to regulate endosperm development and the accumulation of storage substances in rice seeds | ||||
Subcellular localization as per literature | NF-YC12 and NF-YB1 interact to form heterodimer predominantly in the nucleus | ||||
Cells used for localization experiment | Rice protoplast | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 31211389 | ||||
Reference of localization | https://academic.oup.com/jxb/article/70/15/3765/5442606 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.081 | ||||
NLS score | -0.29 | ||||
Protein Sequence | >LOC_Os10g11580.1 protein MPIPEKDGVEDNQEDDTFSRLQLLAQQRHAMEKFWRMSQEQIEESAGNEELILPISRVKNIIHAKEGGMMLSADTPAFVTKLCELFVQELILRAWVCANS HNREIILGTDIAEAITTTESYHFLANVVHGHQALGSNIPEIGVSAWKRHKLDEMTSLCHPPQAVQVTDLANHPPNIPVCPPIGQSGTQHTTSTHVLMMQG ESIHKASKEKSPLKEVMVPTNKVGMTNSSYGVPNGGGATSSKVVIDSPKGETAQVFSSQHACPSLEDNYVIPIPAGHGDSFRTLDEANIPQLHQEQKNFI SQDAIVGENIPLNESLEKSKHKDEDLLFPDKDLPE |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
7 |
|
||||
Presence of Splice variants | No |