 
    | RGAP LOCUS ID | LOC_Os10g06540 | ||||
| RAP-DB ID | Os10g0154000 | ||||
| Function | vesicle-associated membrane protein, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | chlo | ||||
| score | 5 | ||||
| 2) CELLO Prediction | |||||
| localization | PlasmaMembrane | ||||
| score | 3.483 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.2 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.33 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OsVAMP714 | ||||
| Function assigned as per literature | OsVAMP714-mediated trafficking pathway plays an important role in rice blast resistance as well as in the vegetative growth of rice. | ||||
| Subcellular localization as per literature | Chloroplasts | ||||
| Cells used for localization experiment | leaf mesophyll cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26879413 | ||||
| Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-016-0444-0 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.124 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os10g06540.1 protein MAIVYAVVARGTVVLAEFSAVSGNAGAVARRILEKLPPDAESRLCFAQDRYIFHVLRSPPPAAADGLTFLCMANDTFGRRIPFLYLEDIQMRFIKNYGRI AHNALAYAMNDEFSRVLHQQMEYFSSNPSADTLNRLRGEVSEIHTVMVDNIEKILDRGERISLLVDKTSTMQDSAFHFRKQSRRLRRALWMKNAKLLAVL TAVIVLLLYLIIAAFCGGLSLPSCRS | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| 5 | 
 | ||||
| 6 | 
 | ||||
| Presence of Splice variants | YES | ||||