LOC_Os10g06000
| RGAP LOCUS ID | LOC_Os10g06000 | ||||
| RAP-DB ID | Os10g0150800 | ||||
| Function | POEI15 - Pollen Ole e I allergen and extensin family protein precursor, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | extr | ||||
| score | 11 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 1.065 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.05 | ||||
4) Y-Loc Prediction |
|||||
| localization | Mitochondrion | ||||
| score | |||||
| confidence value | 0.03 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsPRP1 | ||||
| Function assigned as per literature | |||||
| Subcellular localization as per literature | NA | ||||
| Cells used for localization experiment | |||||
| NUCLEAR or Not Nuclear | |||||
| PMID | |||||
| Reference of localization | |||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.131 | ||||
| NLS score | -0.04 | ||||
| Protein Sequence | >LOC_Os10g06000.1 protein MAGAPRGLVLLGVCAVLMAVAVGGEAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNGNGEYESKATGKLDGTGVFSIPLDADLHSSDCVAQLHGA TNEPCPGQEPSKIVPMSEGTFIAVAGQTHYPSALCASATICGPIKKKIIDHFHKKPVPPKPEPKPEPPKPKPEPEHPFLDHIHKKEKHFFDHFHKKPVPP KPEPKPEPKPEPKPQPAPEYHNPSPPAKN |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||