RGAP LOCUS ID | LOC_Os10g05750 | ||||
RAP-DB ID | Os10g0148100 | ||||
Function | POEI3 - Pollen Ole e I allergen and extensin family protein precursor, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | extr | ||||
score | 11 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.179 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.07 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.87 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsPRP3 | ||||
Function assigned as per literature | OsPRP3 is a cell wall protein playing a crucial role in determining extracellular matrix structure of floral organs | ||||
Subcellular localization as per literature | Cell wall protein | ||||
Cells used for localization experiment | Transgenic plant leaf | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 19830390 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-009-9557-z | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.107 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os10g05750.1 protein MGALPRALVLGVCAAVLLVNVLAVAADGDAAAAASMVVGLAKCADCTRKNMKAEAVFKGVRVAIKCKNSNGEYETKATGEVGKSGAFAVPLAADLLGDDG ELRQQCFAQLHSAASNQPCPGQEPSWIVNAAADKKKTFVAVAGDTHFPSSECASAFLCDPFHKKDFFFHYKNPSPPAPAAYHKPPPSYTHPAPPVYSYPT PAYSHPTPVYKQPLPTPSPPIYHPPAEEKKVAMQDDAEADPELFKKLLPLIKKNPFLKFPKLPPVEVEAKP |
||||
GO Analysis |
|||||
1 |
|
||||
Presence of Splice variants | No |