LOC_Os09g31031
| RGAP LOCUS ID | LOC_Os09g31031 | ||||
| RAP-DB ID | Os09g0483400 | ||||
| Function | ubiquitin family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | cyto_Nuclear | ||||
| score | 6.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 1.838 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.28 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 83.36 | ||||
| confidence value | 0.3 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | UbL404 | ||||
| Function assigned as per literature | RNase ZS1-mediates UbL40 mRNA regulation and shows that loss of this regulation produces TGMS in rice, a finding with potential applications in hybrid crop breeding | ||||
| Subcellular localization as per literature | cytoplasm | ||||
| Cells used for localization experiment | rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 25208476 | ||||
| Reference of localization | https://www.nature.com/articles/ncomms5884.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.138 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os09g31031.1 protein MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGGSRGGYTIQEPTLRALALKYREKKK VLCTPSHQVSPLPQEEVWPQQGAEVEEEVHQLAFDSVRHWKVFTS |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | YES | ||||