LOC_Os09g20830
| RGAP LOCUS ID | LOC_Os09g20830 |
| RAP-DB ID | Os09g0375100 |
| Function | heat shock factor-binding protein 1, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | extr |
| score | 10 |
2) CELLO Prediction |
|
| localization | Extracellular |
| score | 1.585 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.17 |
4) Y-Loc Prediction |
|
| localization | Secreted pathw |
| score | |
| confidence value | 0.98 |
| Number Of Software Predicting Nucleus | 0 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsHSBP1 |
| Function assigned as per literature | OsHSBP1 plays roles in the regulation of the heat shock response and seed development of rice |
| Subcellular localization as per literature | Cytosol and nucleus |
| Cells used for localization experiment | Onion epidermal cells |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 22996677 |
| Reference of localization | https://academic.oup.com/jxb/article/63/16/6003/730230 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.071 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os09g20830.4 protein MISCLSQILKIAGSILFLMLFVTASVMTQVVQIPLYLFKSNPMMQTLYLVYCKRTQCILCFEAIDSQIRT |
GO Analysis |
|
| Presence of Splice variants | YES |