| RGAP LOCUS ID | LOC_Os09g15670 | ||||
| RAP-DB ID | Os09g0325700 | ||||
| Function | protein phosphatase 2C, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 8 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 2.037 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.34 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 45.58 | ||||
| confidence value | 0.05 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsSIPP2C1|OsPP2C68|OsPP108 | ||||
| Function assigned as per literature | OsSIPP2C1 negatively regulated by ABL1 is involved in abiotic stress and panicle development in rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | rice protoplast cell | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 23086454 | ||||
| Reference of localization | https://link.springer.com/article/10.1007/s12033-012-9614-8 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.131 | ||||
| NLS score | 0.15 | ||||
| Protein Sequence | >LOC_Os09g15670.1 protein MSMAEVCCDSAVVVGAEAEARARARAGRRRRAGVEGAGRWNATATAAGVAAEEAATRKRRASGGEAGLVVVAKRHGAASVAGRRREMEDAVSLREAFAAP ANGEVAAARCDFYGVFDGHGCSHVADACRERMHELVAEEMGAGSPAAAAREPASWTETMERSFARMDAEVIAGCRAESGSCRCEGQKCDHVGSTAVVAVV EESRVVVANCGDSRAVLCRGGAPVQLSSDHKPDRPDELERIEAAGGRVIFWEGARVLGVLAMSRSIGDAYLKPYVTAVPEVTVTGRSDFDECLILASDGL WDVVSNEAACEVAQSCLRRGRQRWCAEAAAVLTKLALARRSSDNISVVVVDLRRGNAL |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | No | ||||