LOC_Os08g44460
| RGAP LOCUS ID | LOC_Os08g44460 | ||||
| RAP-DB ID | Os08g0558900 | ||||
| Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 12 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 2.154 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.15 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 9 | ||||
| confidence value | 0.29 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | IF1-1 | ||||
| Function assigned as per literature | IF1-1 encodes isozymes of the F(1)F(0)-ATPase inhibitor protein of rice mitochondria | ||||
| Subcellular localization as per literature | mitochondria | ||||
| Cells used for localization experiment | onion or dayflower epidermal cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 10664124 | ||||
| Reference of localization | https://link.springer.com/content/pdf/10.1007/PL00008125.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.118 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os08g44460.1 protein MAMRSALTSLPLRLRSPAPVAAACGGMRLMSDGKGRVLSEEERAKENVYVQVYLVAPSPPLVSSALVLSQIRSSAHRYCCCVFFLSFRLAGGAEDGEGED GEAQEEAREGEGGGRQGQSRRLRQEYGGGIQLGVMCFCLKTDLFHMPMLDTGVHTCPRMKE |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | YES | ||||