RGAP LOCUS ID | LOC_Os08g42540 | ||||
RAP-DB ID | Os08g0537800 | ||||
Function | ubiquitin thioesterase otubain-like, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 6 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.694 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.17 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 69.11 | ||||
confidence value | 0.26 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | WTG1|OsOTUB1 | ||||
Function assigned as per literature | OsTUB1 functions as a key QTL responsible for OsSPL14-mediated control of the NPT architecture and is associated with reduced tiller number, increased lodging resistance and higher grain yield in rice | ||||
Subcellular localization as per literature | nuclear and cytoplasm; Specific localization in nucleus when interactng with SPL14 | ||||
Cells used for localization experiment | rice root tip and leaf sheath cells; rice protoplast | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 28776570 | ||||
Reference of localization | https://www.nature.com/articles/cr201798 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.095 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os08g42540.1 protein MGGDYYHSCCGDPDPDLRAPEGPKLPYVGDKEPLSTLAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHILETQDKAEVERILKKI EQCKKTLADLGYIEFTFEDFFSIFIDQLESVLQGHESSIGAEELLERTRDQMVSDYVVMFFRFVTSGEIQRRAEFFEPFISGLTNSTVVQFCKASVEPMG EESDHVHIIALSDALGVPIRVMYLDRSSCDAGNISVNHHDFSPEANSSDGAAAAEKPYITLLYRPGHYDILYPK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |