| RGAP LOCUS ID | LOC_Os08g42540 | ||||
| RAP-DB ID | Os08g0537800 | ||||
| Function | ubiquitin thioesterase otubain-like, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 6 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 1.694 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.17 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 69.11 | ||||
| confidence value | 0.26 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | WTG1|OsOTUB1 | ||||
| Function assigned as per literature | OsTUB1 functions as a key QTL responsible for OsSPL14-mediated control of the NPT architecture and is associated with reduced tiller number, increased lodging resistance and higher grain yield in rice | ||||
| Subcellular localization as per literature | nuclear and cytoplasm; Specific localization in nucleus when interactng with SPL14 | ||||
| Cells used for localization experiment | rice root tip and leaf sheath cells; rice protoplast | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 28776570 | ||||
| Reference of localization | https://www.nature.com/articles/cr201798 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.095 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os08g42540.1 protein MGGDYYHSCCGDPDPDLRAPEGPKLPYVGDKEPLSTLAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHILETQDKAEVERILKKI EQCKKTLADLGYIEFTFEDFFSIFIDQLESVLQGHESSIGAEELLERTRDQMVSDYVVMFFRFVTSGEIQRRAEFFEPFISGLTNSTVVQFCKASVEPMG EESDHVHIIALSDALGVPIRVMYLDRSSCDAGNISVNHHDFSPEANSSDGAAAAEKPYITLLYRPGHYDILYPK |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||