RGAP LOCUS ID | LOC_Os08g37890 | ||||
RAP-DB ID | Os08g0485500 | ||||
Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.106 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.26 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.48 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | AL8|RAE2|GAD1 | ||||
Function assigned as per literature | |||||
Subcellular localization as per literature | NA | ||||
Cells used for localization experiment | |||||
NUCLEAR or Not Nuclear | |||||
PMID | |||||
Reference of localization | |||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.112 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os08g37890.1 protein MRTAATPPLAAAAAAVAAVFLSALLLASASASASRLPPPRRLLPLVGGEVAVAVVAGEEEKVRLGSSPPSCYSKCYGCSPCVAVQVPTLSAPSVPAAAAP RTTPRRSWRRSPTTSR |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |