| RGAP LOCUS ID | LOC_Os08g33370 | ||||
| RAP-DB ID | Os08g0430500 | ||||
| Function | 14-3-3 protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | plas | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Cytoplasmic | ||||
| score | 4.045 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.02 | ||||
4) Y-Loc Prediction |
|||||
| localization | Cytoplasm | ||||
| score | 99 | ||||
| confidence value | 0.97 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | GF14c | ||||
| Function assigned as per literature | GF14c (a 14-3-3 protein) is an Hd3a-interacting protein and acts as an negative flowering of flowering in rice | ||||
| Subcellular localization as per literature | Cytoplasm | ||||
| Cells used for localization experiment | rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 19179350 | ||||
| Reference of localization | https://academic.oup.com/pcp/article/50/3/429/1844138 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.125 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os08g33370.2 protein MSREENVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDG ILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAF DEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGDACEGQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | YES | ||||