RGAP LOCUS ID | LOC_Os08g32130 | ||||
RAP-DB ID | Os08g0416900 | ||||
Function | heat shock protein DnaJ, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 6 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 3.512 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.22 | ||||
4) Y-Loc Prediction |
|||||
localization | Mitochondrion | ||||
score | |||||
confidence value | 0.03 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsV5B | ||||
Function assigned as per literature | OsV5B functions as chaperone proteins of protochlorophyllide oxidoreductase (POR), which catalyzes a light-dependent reaction in the chlorophyll biosynthesis pathway | ||||
Subcellular localization as per literature | Chloroplasts | ||||
Cells used for localization experiment | N. benthamianaleaves | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 27565208 | ||||
Reference of localization | https://academic.oup.com/pcp/article/57/11/2392/2445853 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.112 | ||||
NLS score | -0.29 | ||||
Protein Sequence | >LOC_Os08g32130.2 protein MQQAAVAFGQAAFLARPLRRPPHRLYVRAGWAEAGGVAAGRGRASLPRPRLSASLSIGAGGYGDEHAPLFPRQQAWDPYKILGVDHDASEEEIRSARNFL LKQYAGHEETEEAIEGAYEKIIMKSYSHRKKSKINLKSKIQKQVEESPSWFKAMLGFFEVPSAEIISRRLALFAFIAGWSIVTSAETGPTFQLALSLVSC IYFLNEKMKNLSRASMTGFGVFVGGWIVGSLLVPVIPTFAIPPTWSIELLSSLVAYVFLFLGCTFLK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |