RGAP LOCUS ID | LOC_Os08g17680 | ||||
RAP-DB ID | Os08g0278900 | ||||
Function | stromal cell-derived factor 2-like protein precursor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | extr | ||||
score | 4 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 2.85 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.24 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.95 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsSDF2-1 | ||||
Function assigned as per literature | OsSDF2-1 is essential for XA21-mediated immunity in rice | ||||
Subcellular localization as per literature | ER | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 23849113 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945213001118?via%3Dihub | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.101 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os08g17680.1 protein MAAASFAIALLLYLGLDLPEASPAQSYAADPDNVVEITYGSAIKLMHERTKFRLHSHDVPYGSGSGQQSVTSFPNVDDSNSYWIVRPQPDTSAKQGDPIT HGTVVRLQHMRTRKWLHSHMHASPITGNLEVSCFGGENESDTGDYWRLEIEGSGKSWRQNQKIRLRHVDTGGYLHSHDRKYTRIAGGQQEVCGVGDKRPD NVWLAAEGVYLPVNQQK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | No |