RGAP LOCUS ID | LOC_Os08g10480 | ||||
RAP-DB ID | Os08g0205400 | ||||
Function | heavy metal-associated domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.813 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.02 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 94 | ||||
confidence value | 0.71 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsATX1 | ||||
Function assigned as per literature | OsATX1 plays an important role in facilitating root-to-shoot Cu translocation and the redistribution of Cu from old leaves to developing tissues and seeds in rice | ||||
Subcellular localization as per literature | cytoplasm and Nucleus | ||||
Cells used for localization experiment | rice mesophyll protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30002257 | ||||
Reference of localization | http://www.plantphysiol.org/content/178/1/329 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.127 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os08g10480.1 protein MSCEGCVGAVKRVLGKMQGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTGKKTSFWDAEPAPVEATAASS | ||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |