 
    | RGAP LOCUS ID | LOC_Os08g09940 | ||||
| RAP-DB ID | Os08g0199300 | ||||
| Function | GTP-binding protein, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | cysk | ||||
| score | 5 | ||||
| 2) CELLO Prediction | |||||
| localization | Cytoplasmic | ||||
| score | 4.394 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.18 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Mitochondrion | ||||
| score | |||||
| confidence value | 0.59 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OsYchF1 | ||||
| Function assigned as per literature | OsYchF1 and OsGAP1 are involved in plant defense response | ||||
| Subcellular localization as per literature | Plasma membrane | ||||
| Cells used for localization experiment | Leaf samples of 8-week-old rice plantsĀ | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 20876569 | ||||
| Reference of localization | http://www.jbc.org/content/285/48/37359.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.14 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os08g09940.1 protein MPPKASKKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVR GAHAGEGLGNAFLSHIRAVDGIFHVLRAFEDKEVTHIDDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKD VRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFA AIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| Presence of Splice variants | No | ||||