| RGAP LOCUS ID | LOC_Os08g02490 | ||||
| RAP-DB ID | Os08g0118000 | ||||
| Function | AT hook motif domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | E.R. | ||||
| score | 4.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.132 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.18 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 66.77 | ||||
| confidence value | 0.19 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsAHL1|AHL1 | ||||
| Function assigned as per literature | AHL1 is a novel plant matrix attachment region (MAR) binding protein involved in positioning chromatin fibers in the nucleus by an AT-hook motif and PPC (plants and prokaryotes conserved) | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Tobacco BY-2 cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 15604740 | ||||
| Reference of localization | https://link.springer.com/article/10.1007/s11103-004-3249-5 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.075 | ||||
| NLS score | 0.03 | ||||
| Protein Sequence | >LOC_Os08g02490.1 protein MEAKSGEASVAPVAVATEATAATVSFQPQAAVAEQGSSSGGVLVPPPPMAAGGGGVVVAAAPVAGVVKVGKKRGRPRKYGPDGSLIRPLNATPISASVPM AASAVGPYTPASAVGAAMKRGRGRPLDFASTAKLHHHHQHQHHHQQQQFGFHFDSIGEMVACSAGANFTPHIITVAPGEDVTMKVISFSQQGPRAICILS ANGVISNVTLRQPDSSGGTLTYEGRFELLSLSGSFMPTENSGTRSRSGGMSVSLASPDGRVVGGGVAGLLVAASPVQIVVGSFLPSYQMEQKNKKPRVEA APALAQTPPAVPISSTDTHSSEQGQHSSVAPRTTNIVTSAYNPDQSWASPAQSIPDSARTPSGDVKVTASGA |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | No | ||||