LOC_Os07g47670
| RGAP LOCUS ID | LOC_Os07g47670 | ||||
| RAP-DB ID | Os07g0673900 | ||||
| Function | hypoxia-responsive family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 6.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 1.379 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.07 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 4 | ||||
| confidence value | 0.06 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsHIGD2 | ||||
| Function assigned as per literature | OsHIGD2 is a mitochondrial protein which takes part in the early stage of hypoxia signalling by interacting with proteins that are related to oxygen utilization | ||||
| Subcellular localization as per literature | Mitochondria | ||||
| Cells used for localization experiment | N. benthamiana | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 27306456 | ||||
| Reference of localization | https://link.springer.com/article/10.1007%2Fs00299-016-2013-z | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.119 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os07g47670.2 protein MAEEKSTMQSMREWVVDHKLRAVGTLWLTGVASSIAYNWSRPGMKTSVKIIHARLHAQALTLAALAGSALVEYYDHRSGSGSRVHQYAKQFITPESNPQK E |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | YES | ||||