| RGAP LOCUS ID | LOC_Os07g42370 | ||||
| RAP-DB ID | Os07g0615200 | ||||
| Function | zinc-finger protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 12 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.007 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.49 | ||||
4) Y-Loc Prediction |
|||||
| localization | Mitochondrion | ||||
| score | |||||
| confidence value | 0.09 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | Tify | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsJAZ7|OsTIFY10b | ||||
| Function assigned as per literature | |||||
| Subcellular localization as per literature | NA | ||||
| Cells used for localization experiment | |||||
| NUCLEAR or Not Nuclear | |||||
| PMID | |||||
| Reference of localization | |||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.127 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os07g42370.1 protein MAASARPVGVGGERATSFAMACSLLSRYVRQNGAAAAELGLGIRGEGEAPRAAPATMSLLPGEAERKKETMELFPQSAGFGQQDAITADSAADAREQEPE KRQLTIFYGGKVLVFNDFPADKAKGLMQLASKGSPVAPQNAAAPAPAAVTDNTKAPMAVPAPVSSLPTAQADAQKPARANASDMPIARKASLHRFLEKRK DRLNAKTPYQASPSDATPVKKEPESQPWLGLGPNAVVKPIERGQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||