| RGAP LOCUS ID | LOC_Os07g40240 | ||||
| RAP-DB ID | Os07g0592000 | ||||
| Function | GASR9 - Gibberellin-regulated GASA/GAST/Snakin family protein precursor, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 3.52 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.11 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.96 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsGASR9 | ||||
| Function assigned as per literature | OsGASR9 positively regulates grain size and yield in rice. | ||||
| Subcellular localization as per literature | Plasma membrane, cytoplasm and nucleus | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 31300138 | ||||
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945218312044 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.137 | ||||
| NLS score | 0.21 | ||||
| Protein Sequence | >LOC_Os07g40240.1 protein MRVPPLRATTALLATLLVAASFQDLTVAADGGGGVVPVPDSVCDAKCQKRCSLKVAGRCMGLCKMCCHDCGGCVPSGPYASKDECPCYRDMVSPKSRRPK CP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | No | ||||