| RGAP LOCUS ID | LOC_Os07g39220 | ||||
| RAP-DB ID | Os07g0580500 | ||||
| Function | BES1/BZR1 homolog protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.632 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.67 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 53.72 | ||||
| confidence value | 0.15 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | BES1 | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsBZR1 | ||||
| Function assigned as per literature | OsBZR1 along with 14-3-3 proteins function in brassinosteroid signaling in rice | ||||
| Subcellular localization as per literature | Nucleus and cytoplasm but binding by 14-3-3 Proteins Reduces the Nuclear Localization of OsBZR1 | ||||
| Cells used for localization experiment | Tobacco leaf epidermal cells or in stably transformed Arabidopsis plants | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 17699623 | ||||
| Reference of localization | http://www.pnas.org/content/104/34/13839.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 3 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.117 | ||||
| NLS score | 0.96 | ||||
| Protein Sequence | >LOC_Os07g39220.1 protein MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQL LSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRG RRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | No | ||||