| RGAP LOCUS ID | LOC_Os07g38600 | ||||
| RAP-DB ID | Os07g0573600 | ||||
| Function | REX1 DNA Repair family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 8 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.8 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.46 | ||||
4) Y-Loc Prediction |
|||||
| localization | Mitochondrion | ||||
| score | |||||
| confidence value | 0.08 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsREX1-S | ||||
| Function assigned as per literature | OsREX1-S renders plant cells tolerant to cadmium- and UV-induced damage by enhancing DNA excision repair | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 24563249 | ||||
| Reference of localization | https://link.springer.com/article/10.1007%2Fs00425-014-2042-1 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.13 | ||||
| NLS score | 0.02 | ||||
| Protein Sequence | >LOC_Os07g38600.1 protein MPDLRLRSSALSRAPPPPPLQAPCSSPVCSYRSVQRRTGAREDNSTGRRQRWHSVLQRAENMVNAIKGLFISCDVPMAQFIVNLNASMPASDKFILHMLD PTHMFVQPHVAEMIRSKISEFRDQNSYEKPT |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | No | ||||