RGAP LOCUS ID | LOC_Os07g37740 | ||||
RAP-DB ID | Os07g0564600 | ||||
Function | secretory carrier-associated membrane protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 3.958 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.08 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 95.06 | ||||
confidence value | 0.89 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsSCAMP1 | ||||
Function assigned as per literature | SCAMP1 defines clathrin-coated, trans-golgi–located tubular-vesicular structures as an early endosome | ||||
Subcellular localization as per literature | Plasma membrane | ||||
Cells used for localization experiment | Tobacco BY-2 cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 17209124 | ||||
Reference of localization | http://www.plantcell.org/content/19/1/296.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.105 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os07g37740.1 protein MAGRYDSNPFEEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSVSSNSRLSPLPPEPAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELK RREEAAARAGIVIEEKNWPPFLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKIWLLAIIYFISGVPGAYVLWYRPLYNA MRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVFEGKSLAGILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGKAAEMKRDATRG AMRAAF |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |