RGAP LOCUS ID | LOC_Os07g08420 | ||||
RAP-DB ID | Os07g0182000 | ||||
Function | bZIP transcription factor domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.607 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.73 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 1 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | Yes | ||||
Transcription factor category | bZIP | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | RISBZ1|OsbZIP58|OsSMF1 | ||||
Function assigned as per literature | RISBZ1 is a transcriptional activator of rice seed storage protein genes | ||||
Subcellular localization as per literature | Nuclear | ||||
Cells used for localization experiment | rice protoplast | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 19473328 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-313X.2009.03925.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 3 | ||||
Basic residues % | 0.089 | ||||
NLS score | 1.32 | ||||
Protein Sequence | >LOC_Os07g08420.1 protein MEHVFAVDEIPDPLWAPPPPVQPAAAAGVDDVGAVSGGGLLERCPSGWNLERFLEELDGVPAPAASPDGAAIYPSPMPAAAAEAAARWSRGYGDREAVGV MPMPAAALPAAPASAAMDPVEYNAMLKRKLDEDLATVAMWRASGAIHSESPLGNKTSLSIVGSILSSQKCIEGNGILVQTKLSPGPNGGSGPYVNQNTDA HAKQATSGSSREPSPSEDDDMEGDAEAMGNMILDEEDKVKKRKESNRESARRSRSRKAARLKDLEEQVSLLRVENSSLLRRLADANQKYSAAAIDNRVLM ADIEALRAKVRMAEESVKMVTGARQLHQAIPDMQSPLNVNSDASVPIQNNNPMNYFSNANNAGVNSFMHQVSPAFQIVDSVEKIDPTDPVQLQQQQMASL QHLQNRACGGGASSNEYTAWGSSLMDANELVNMELQ |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |