| RGAP LOCUS ID | LOC_Os07g08420 | ||||
| RAP-DB ID | Os07g0182000 | ||||
| Function | bZIP transcription factor domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.607 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.73 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 1 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | Yes | ||||
| Transcription factor category | bZIP | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | RISBZ1|OsbZIP58|OsSMF1 | ||||
| Function assigned as per literature | RISBZ1 is a transcriptional activator of rice seed storage protein genes | ||||
| Subcellular localization as per literature | Nuclear | ||||
| Cells used for localization experiment | rice protoplast | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 19473328 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-313X.2009.03925.x | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 3 | ||||
| Basic residues % | 0.089 | ||||
| NLS score | 1.32 | ||||
| Protein Sequence | >LOC_Os07g08420.1 protein MEHVFAVDEIPDPLWAPPPPVQPAAAAGVDDVGAVSGGGLLERCPSGWNLERFLEELDGVPAPAASPDGAAIYPSPMPAAAAEAAARWSRGYGDREAVGV MPMPAAALPAAPASAAMDPVEYNAMLKRKLDEDLATVAMWRASGAIHSESPLGNKTSLSIVGSILSSQKCIEGNGILVQTKLSPGPNGGSGPYVNQNTDA HAKQATSGSSREPSPSEDDDMEGDAEAMGNMILDEEDKVKKRKESNRESARRSRSRKAARLKDLEEQVSLLRVENSSLLRRLADANQKYSAAAIDNRVLM ADIEALRAKVRMAEESVKMVTGARQLHQAIPDMQSPLNVNSDASVPIQNNNPMNYFSNANNAGVNSFMHQVSPAFQIVDSVEKIDPTDPVQLQQQQMASL QHLQNRACGGGASSNEYTAWGSSLMDANELVNMELQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | No | ||||