RGAP LOCUS ID | LOC_Os07g07350 | ||||
RAP-DB ID | Os07g0168800 | ||||
Function | zinc finger A20 and AN1 domain-containing stress-associated protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 11 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.158 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.18 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 76.79 | ||||
confidence value | 0.65 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | ZFP177 | ||||
Function assigned as per literature | FP177 might play crucial but differential roles in plant responses to various abiotic stresses | ||||
Subcellular localization as per literature | cytoplasm | ||||
Cells used for localization experiment | tobacco leaf and root cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 18588956 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0378111908002205?via%3Dihub | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.137 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os07g07350.3 protein MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKKAFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQEPPKPPSN RCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIAEKINKI |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |