RGAP LOCUS ID | LOC_Os06g49080 | ||||
RAP-DB ID | Os06g0704300 | ||||
Function | zinc finger C-x8-C-x5-C-x3-H type family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.312 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.53 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 90.29 | ||||
confidence value | 0.14 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | C3H | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | LIC|OsLIC1 | ||||
Function assigned as per literature | Regulator of rice achitecture | ||||
Subcellular localization as per literature | Nucleus and cytoplasm | ||||
Cells used for localization experiment | Onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 18953406 | ||||
Reference of localization | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0003521 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.09 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os06g49080.1 protein MSRRQEICRNFQRGSCKYGAQCRYLHASPHQQQQQQQAKPNPFGFGTGSRQQQQPSFGSQFQQQQQQQQKPNPFGFGVQGANAQSRNAPGPAKPFQNKWV RDPSAPTKQTEAVQPPQAQAAHTSCEDPQSCRQQISEDFKNEAPIWKLTCYAHLRNGPCNIKGDISFEELRAKAYEEGKQGHSLQSIVEGERNLQNAKLM EFTNLLNSARPSQTPSFPTMSSFPEVKNNSSFGASQTNGPPVFSSFSQIGAATNIGPGPGTTAPGMPASSPFGHPSSAPLAAPTFGSSQMKFGVSSVFGN QGSGQPFGSFQAPRFPSSKSPASSVQHRDIDRQSQELLNGMVTPPSVMFEESVGNNKNENQDDSIWLKEKWAIGEIPLDEPPQRHVSHVF |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |