LOC_Os06g45540
| RGAP LOCUS ID | LOC_Os06g45540 | ||||
| RAP-DB ID | Os06g0666100 | ||||
| Function | zinc-binding protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.663 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.58 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 98.09 | ||||
| confidence value | 0.51 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | PLATZ | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | GL6|SG6 | ||||
| Function assigned as per literature | SG6 determines grain size by regulating spikelet hull cell division. | ||||
| Subcellular localization as per literature | Ubiquitously localized throughout the cells including nucleus | ||||
| Cells used for localization experiment | Arabidopsis protoplasts and Nicotiana benthamiana epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 31207036 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/abs/10.1111/jipb.12851 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.107 | ||||
| NLS score | 0.52 | ||||
| Protein Sequence | >LOC_Os06g45540.1 protein MGMRPGWVGGLVEESFFVGCPAHESRKKNEKNIFCLGCCASICPHCAPSHRHHPLLQVRRYVYNDVVRLDDLDKLIDCSFVQPYTINSAKVIFLKPRPQS RPFKGSGNICLTCDRILQEPFHFCCLSCKVDHVMMQGGDLSNILYMSGGSSGEPDLAAGFPRFENLRVDGGGGGGGGLSDDDDDHQVTTPNSILEDPLHH HHHQYYGGGGSSNNGRSTSPAPTTADVPRKKKSGGGGGFFPQIVLSLNNRRKGAPHRSPLA |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||