| RGAP LOCUS ID | LOC_Os06g45140 | ||||
| RAP-DB ID | Os06g0662200 | ||||
| Function | bZIP transcription factor domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 4.661 | ||||
3) NUCPRED Prediction |
|||||
| localization | Nuclear | ||||
| score | 0.83 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 1 | ||||
| Number Of Software Predicting Nucleus | 4 | ||||
| Seed Specific | No | ||||
| Transcription factor category | bZIP | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsbZIP52|RISBZ5 | ||||
| Function assigned as per literature | OsbZIP52/RISBZ5 could function as a negative regulator in cold and drought stress environments | ||||
| Subcellular localization as per literature | Nuclear | ||||
| Cells used for localization experiment | onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 22189955 | ||||
| Reference of localization | https://link.springer.com/article/10.1007%2Fs00425-011-1564-z | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 2 | ||||
| Basic residues % | 0.136 | ||||
| NLS score | 0.99 | ||||
| Protein Sequence | >LOC_Os06g45140.1 protein MMKKCPSELQLEAFIREEAGAGDRKPGVLSPGDGARKSGLFSPGDGEMSVLDQSTLDGSGGGHQLWWPESVRTPPRAAAAFSATADERTPASISDDPKPT TSANHAPESDSDSDCDSLLEAERSPRLRGTKSTETKRIRRMVSNRESARRSRRRKQAQLSELESQVEQLKGENSSLFKQLTESSQQFNTAVTDNRILKSD VEALRVKVKMAEDMVARAAMSCGLGQLGLAPLLSSRKMCQALDMLSLPRNDACGFKGLNLGRQVQNSPVQSAASLESLDNRISSEVTSCSADVWP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | YES | ||||