| RGAP LOCUS ID | LOC_Os06g44860 | ||||
| RAP-DB ID | Os06g0659100 | ||||
| Function | OsSPL10 - SBP-box gene family member, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.676 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.71 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.99 | ||||
| confidence value | 0.96 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | SBP | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsSPL10 | ||||
| Function assigned as per literature | OsSPL10 negatively controls salt tolerance but positively controls trichome formation in rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | epidermal cells of Nicotiana benthamiana (tobacco) leaves | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 31611344 | ||||
| Reference of localization | https://www.g3journal.org/content/9/12/4107.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 4 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.087 | ||||
| NLS score | 1.41 | ||||
| Protein Sequence | >LOC_Os06g44860.1 protein MMSGRMNAAGDESPFPFGAMQAPGPGAYVGFDHGAAAVAAAAAAAQRAGMLQHHHHHMYDGLDFAAAMQFGGGQDAPPHPQLLALPPSMAAPPPPPMPMP LQMPMTMPMPGDVYPALGIVKREGGGGGQDAAAGRIGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKHYHRRH KVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPAAAATTAVAAAKDAAAAPVAAGKKPSGGAATSYTGDNKNVVSMSA AKSPISSNTSVISCLPEQGKHAAAAARPTALTLGGAPPHESSAPQIGAMLHHHHHHQQDHMQVSSLVHINGGGGGGSNNILSCSSVCSSALPSTATNGEV SDQNNDNSHNNGGNNNNMHLFEVDFM |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | No | ||||