RGAP LOCUS ID | LOC_Os06g40620 | ||||
RAP-DB ID | Os06g0608500 | ||||
Function | SNF7 domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 5 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.864 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.63 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 98.61 | ||||
confidence value | 0.8 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsSNF7 | ||||
Function assigned as per literature | OsSNF7 may functions in immunity and cell death in plants | ||||
Subcellular localization as per literature | Multivesicular bodies (MVBs) | ||||
Cells used for localization experiment | Nicotiana benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 27618555 | ||||
Reference of localization | http://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1006311 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.127 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os06g40620.2 protein MSGVFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKTFTKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKA TTETVDALRTGASAMKAMHKATNIDDVDKTMDEINDNMENMRQIQDLLSAPIGAAADFDEDELEAELADLEGEELEAELLAPTTTAPTAPVRVQQPTRPS AQSSKTEDDELAALQAEMAM |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |