LOC_Os06g40620
| RGAP LOCUS ID | LOC_Os06g40620 | ||||
| RAP-DB ID | Os06g0608500 | ||||
| Function | SNF7 domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 1.864 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.63 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 98.61 | ||||
| confidence value | 0.8 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsSNF7 | ||||
| Function assigned as per literature | OsSNF7 may functions in immunity and cell death in plants | ||||
| Subcellular localization as per literature | Multivesicular bodies (MVBs) | ||||
| Cells used for localization experiment | Nicotiana benthamiana leaves | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 27618555 | ||||
| Reference of localization | http://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1006311 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.127 | ||||
| NLS score | -0.16 | ||||
| Protein Sequence | >LOC_Os06g40620.2 protein MSGVFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKTFTKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKA TTETVDALRTGASAMKAMHKATNIDDVDKTMDEINDNMENMRQIQDLLSAPIGAAADFDEDELEAELADLEGEELEAELLAPTTTAPTAPVRVQQPTRPS AQSSKTEDDELAALQAEMAM |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | YES | ||||