LOC_Os06g36390
| RGAP LOCUS ID | LOC_Os06g36390 |
| RAP-DB ID | Os06g0559400 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | mito |
| score | 8 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 4.002 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.43 |
4) Y-Loc Prediction |
|
| localization | Nuclear |
| score | 99.96 |
| confidence value | 0.97 |
| Number Of Software Predicting Nucleus | 2 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsO3L2 |
| Function assigned as per literature | OsO3L2 is histone H2A interacting nuclear proteins in vascular cells and especially in the root tip region and interaction with histone H2A modifies chromatin to regulate downstream gene expression |
| Subcellular localization as per literature | OsO3L2 is colocalized with H2A in Nucleus |
| Cells used for localization experiment | Onion epidermal cells |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 29684657 |
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S1871678417305198?via%3Dihub |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.096 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os06g36390.1 protein MGGIARRRGGGDQGGVAAAAGGDGEAAASGFSSGDSSATTTLRSPASSSLTDDGGEVTSWTSADGGGGGDYCSFSCSSESELELESDDDDDEEEEEMMQL DGGGHAAGGPLYELAAPLLAQLPLRAIQVLPREVPILHIALQRQVRPRPCKEDNPLHHQDEAAAAQRPWSRGSVVEFASRSRALQQDDGEEGDEVLVRSI AVKSKGAQASSQQQQHTCTTEQERAVKMLVERQYRGTEKKMEMRFFNKMNSSAISTQLHWS |
GO Analysis |
|
| Presence of Splice variants | YES |