RGAP LOCUS ID | LOC_Os06g30370 | ||||
RAP-DB ID | Os06g0498800 | ||||
Function | osMFT1 MFT-Like1 homologous to Mother of FT and TFL1 gene; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 10 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 1.288 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.11 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 45.9 | ||||
confidence value | 0.07 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsMFT1 | ||||
Function assigned as per literature | OsMFT1 is a suppressor of flowering acting downstream of Ghd7 and upstream of Ehd1, and a positive regulator of panicle architecture. | ||||
Subcellular localization as per literature | OsMFT1 is co-localized with GHD7 in Nucleus | ||||
Cells used for localization experiment | Rice protoplasts cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30124949 | ||||
Reference of localization | https://academic.oup.com/jxb/article/69/18/4283/5042223 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.108 | ||||
NLS score | 0.27 | ||||
Protein Sequence | >LOC_Os06g30370.1 protein MASHVDPLVVGRVIGDVVDLFVPTTAMSVRFGTKDLTNGCEIKPSVAAAPPAVQIAGRVNELFALVMTDPDAPSPSEPTMREWLHWLVVNIPGGTDPSQG DVVVPYMGPRPPVGIHRYVMVLFQQKARVAAPPPDEDAARARFSTRAFADRHDLGLPVAALYFNAQKEPANRRRRY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |