LOC_Os06g29730
| RGAP LOCUS ID | LOC_Os06g29730 |
| RAP-DB ID | Os06g0493100 |
| Function | RALFL28 - Rapid ALkalinization Factor RALF family protein precursor, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | extr |
| score | 10 |
2) CELLO Prediction |
|
| localization | Extracellular |
| score | 2.92 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.04 |
4) Y-Loc Prediction |
|
| localization | Secreted pathw |
| score | |
| confidence value | 1 |
| Number Of Software Predicting Nucleus | 0 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | Bphi008a |
| Function assigned as per literature | Bphi008a interacts with a b-ZIP transcription factor (OsbZIP60) and a RNA polymerase polypeptide (SDRP). |
| Subcellular localization as per literature | Plasma membrane and the nucleus |
| Cells used for localization experiment | onion epidermal cells |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 21487048 |
| Reference of localization | http://www.plantphysiol.org/content/156/2/856.long |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.073 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os06g29730.1 protein MASLRATTLLVLMQIIMVFYTVILSCSFSDARTFPGGEGGLDPNHPVCVGGACPTPGLPYTNPRDPCIYRNRCNPPGRMGDP |
GO Analysis |
|
| Presence of Splice variants | No |