| RGAP LOCUS ID | LOC_Os06g15620 | ||||
| RAP-DB ID | Os06g0266800 | ||||
| Function | GASR7 - Gibberellin-regulated GASA/GAST/Snakin family protein precursor, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | extr | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 3.685 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.02 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.99 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsGSR1 | ||||
| Function assigned as per literature | OsGSR1 plays important roles in both gibberellins and brassinosteroids pathways in rice, and also mediates an interaction between the two signaling pathways. | ||||
| Subcellular localization as per literature | Plasma membrane, cytoplasm and nucleus | ||||
| Cells used for localization experiment | Onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 18980660 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-313X.2008.03707.x | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.127 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os06g15620.1 protein MASSTKIPFLLLAVLLLLSIAFPSEVMAGGRGRGGGGGGGVAGGGNLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNW KTKEGGPKCP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||