RGAP LOCUS ID | LOC_Os06g12310 | ||||
RAP-DB ID | Os06g0228200 | ||||
Function | aquaporin protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | E.R. | ||||
score | 4 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 4.755 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.94 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | Lsi6 | ||||
Function assigned as per literature | Lsi6 is a transporter responsible for the transport of Si out of the xylem and subsequently affects the distribution of Si in the leaf. | ||||
Subcellular localization as per literature | Plasma membrane | ||||
Cells used for localization experiment | Onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 18515498 | ||||
Reference of localization | http://www.plantcell.org/content/20/5/1381.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.054 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os06g12310.1 protein MASTTAPSRTNSRVNYSNEIHDLSTVQSVSAVPSVYYPEKSFADIFPPNLLKKVISEVVATFLLVFVTCGAASIYGEDMKRISQLGQSVVGGLIVTVMIY ATGHISGAHMNPAVTLSFAFFRHFPWIQVPFYWAAQFTGAMCAAFVLRAVLYPIEVLGTTTPTGPHWHALVIEIVVTFNMMFVTCAVATDSRAVGELAGL AVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVYTGLWIYFLGPVVGTLSGAWVYTYIRFEEAPAAAGGAAPQKLSSFKLRRLQSQSMAADEFDNV |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |