| RGAP LOCUS ID | LOC_Os06g09910 | 
                        
                            | RAP-DB ID | Os06g0199500 | 
                        
                            | Function | phosphopantothenoylcysteine decarboxylase, putative, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | chlo | 
                        
                            | score | 6 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | PlasmaMembrane | 
                        
                            | score | 1.607 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.19 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Chloroplast | 
                        
                            | score | 5 | 
                        
                            | confidence value | 0.15 | 
                        
                            | Number Of Software Predicting Nucleus | 0 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category |  | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | OsHAL3 | 
                        
                            | Function assigned as per literature | OsHAL3 plays an important role in photoperiodic control of flowering time in rice | 
                        
                            | Subcellular localization as per literature | Nucleus and cytoplasm | 
                        
                            | Cells used for localization experiment | Tobacco leaf epidermal cells | 
                        
                            | NUCLEAR or Not Nuclear | NUCLEAR | 
                        
                            | PMID | 26537047 | 
                        
                            | Reference of localization | https://www.cell.com/action/showPdf?pii=S1674-2052%2815%2900424-4 | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 0 | 
                        
                            | Number of PAT7 | 0 | 
                        
                            | Number of Bipartite | 0 | 
                        
                            | Basic residues % | 0.095 | 
                        
                            | NLS score | -0.47 | 
                        
                            | Protein Sequence | >LOC_Os06g09910.1 protein MTTSESVQETLGLDFPHPSKPRVLLAASGSVAAIKFESLCRSFSEWAEVRAVATKASLHFIDRTSLPSNIILYTDDDEWSTWKKIGDEVLHIELRKWADI
 MVIAPLSANTLAKIAGGLCDNLLTCIVRAWDYSKPLFVAPAMNTFMWNNPFTSRHLETINLLGISLVPPITKRLACGDYGNGAMAEPSVIDSTVRLACKR
 QPLNTNSSPVVPAGRNLPSS
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | metabolic process |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | nucleotide binding |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | cytosol |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to stress |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to abiotic stimulus |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |  | 
                                                                
                                    | 7 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biosynthetic process |  | 
                                                                
                                    | 8 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | catalytic activity |  | 
                                                        
                            | Presence of Splice variants | YES |